PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10017217m
Common NameCICLE_v10017173mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 117aa    MW: 13307.7 Da    PI: 10.3016
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10017217mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY711.7e-221269259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                     +Dgy+W+KYGqK +k+ +  rsY++C  ++C++kk+ e +++dp+ v i+Y g H h+
  Ciclev10017217m 12 EDGYEWKKYGQKFIKNIRKFRSYFKCQESSCMAKKRAEWCTSDPTNVRIVYDGVHSHT 69
                     7********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182901.26E-21669IPR003657WRKY domain
PROSITE profilePS5081118.728671IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-22969IPR003657WRKY domain
SMARTSM007741.7E-211170IPR003657WRKY domain
PfamPF031061.4E-191268IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MDRRVHRLVL PEDGYEWKKY GQKFIKNIRK FRSYFKCQES SCMAKKRAEW CTSDPTNVRI  60
VYDGVHSHTH HGSSPSSADQ PRRGSSNTSS NGNQYNLLTQ VFGDQSSNAP PASRRN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006445572.12e-84hypothetical protein CICLE_v10017173mg
RefseqXP_006488951.12e-84PREDICTED: probable WRKY transcription factor 23 isoform X1
TrEMBLA0A067EH102e-84A0A067EH10_CITSI; Uncharacterized protein
TrEMBLA0A067EHB32e-84A0A067EHB3_CITSI; Uncharacterized protein
TrEMBLV4TYX72e-84V4TYX7_9R
STRINGPOPTR_0001s03970.12e-35(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.21e-13WRKY DNA-binding protein 57